Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kluyveromyces lactis Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

This Recombinant Kluyveromyces lactis Mitochondrial import inner membrane translocase subunit TIM50 (TIM50) spans the amino acid sequence from region 40-480.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM50

UniProt

Q6CM45

Expression Region

40-480

Origin

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QKKNEKNEAPKSILDDDMLARAGVEVEGNEAGSKDKSGRAGEAGESAEQDDSTGDKGSGK KKRSRKSSTDIKRERYANWFYILSLLGLASGALSMARDWDSDESEELKKEIPNGYTPALM YKRMKRRWESIFTFFQEPPFPDLLPPPPPPPYQRPLTLVLSLEDLLVHSEWTQQSGWRTA KRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKEHCLYKDGVHI KDLSKLNRDLGKVLIIDTDENSFKLQPENAIYLEPWDGKADDRLLRLIPFLEYLATQQVS DVRPILKSFPDNKNIPEAFEKRVQVLKEKFERDERVKNDKNLFLKLLGIGLIGTKPKFPL DLIREEGEKNYVRFMKLVEEEKEKIKLQQQAMGQQTFTLKDYVEGNIPTPEEQLKLQMEK QQEIEAQFEEQKKLKAQQGSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF696 siRNA
abx941021-01 15 nmol

Human ZNF696 siRNA

Sign In for Pricing
View Details
Human ZNF696 siRNA
abx941021-02 30 nmol

Human ZNF696 siRNA

Sign In for Pricing
View Details
Recombinant Human CRY1, His-tagged
CRY1-11596H 25 µg

Recombinant Human CRY1, His-tagged

Sign In for Pricing
View Details
Anti-LPAR3 Antibody Picoband®, Dylight550 Conjugate
A06597-3-Dylight550 100 µg

Anti-LPAR3 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
NAAA Antibody, Biotin conjugated
CSB-PA22919D0Rb-01 50 µg

NAAA Antibody, Biotin conjugated

Sign In for Pricing
View Details
NAAA Antibody, Biotin conjugated
CSB-PA22919D0Rb-02 100 µg

NAAA Antibody, Biotin conjugated

Sign In for Pricing
View Details