Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Putative zinc metalloprotease PM1991 (PM1991)

This Recombinant Pasteurella multocida Putative zinc metalloprotease PM1991 (PM1991) spans the amino acid sequence from region 1-442.

Product Specifications

Product Name Alternative

Putative zinc metalloprotease PM1991, EC= 3.4.24.-

UniProt

Q9CJL2

Expression Region

1-442

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFLWSFASFIIVISVLVAVHEYGHFWAARKCGIQVHRFSIGFGKVLWSRTDKQGTEFVI SAIPLGGYVKMLDGRNEVVPPELSSRAFDQKSVLQRAFVIAAGPIANFLFAILAYFTIYT VGIPTVKPVIADISSNSIAAQAQIEPNTQIMAVDGTKVSDWETINMLLATKMGNDEIHLT LSPFGSSIEQHKVLNTKDWRFDPEKESAMSSLGLQPVRTKVDMILSKVEVNSPADKAGLK AGDRIYAGEQLISWQQFVQFVQEGKPFNVKVERDGQFSFVVLTPELNKKGRWYVGIAPTA APISDIYRTELKYGILEALQKGVEKTIQLSWLTIKVIGKLFTGDLALKNLGGPISIAKGA GISSEIGLIYYLGFMALISVNLGIMNLFPLPVLDGGHLVFLAAEAVRGKPLSERIQNLSY RIGAAILMALMGFALFNDFLRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-100 1x 100 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-500 1x 500 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-100 1x 100 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details