Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage If1 Attachment protein G3P (III)

This Recombinant Enterobacteria phage If1 Attachment protein G3P (III) spans the amino acid sequence from region 17-460.

Product Specifications

Product Name Alternative

Attachment protein G3P, Gene 3 protein, G3P, Minor coat protein

UniProt

O80297

Expression Region

17-460

Origin

Enterobacteria phage If1 (Bacteriophage If1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATTDAECLSKPAFDGTLSNVWKEGDSRYANFENCIYELSGIGIGYDNDTSCNGHWTPVRA ADGSGNGGDDNSSGGGSNGDSGNNSTPDTVTPGQTVNLPSDLSTLSIPANVVKSDSIGSQ FSLYTNASCTMCSGYYLSNNADSIAIANITETVKADYNQPDMWFEQTDSDGNHVKILQNS YKAVSYNVESKQSDVNNPTYINYSYSVNVKQVSYDTSNVCIMNWETFQNKCDASRAVLIT DTVTPSYSRNITIQSNINYQGSNGSGGSGGSGGSGNDGGGTGNNGNGTGDFDYVKMANAN KDALTESFDLSALQADTGASLDGSVQGTLDSLSGFSDSIGGLVGNGSAISGEFAGSSAAM NAIGEGDKSPLLDSLSFLKDGLFPALPEFKQCTPFVFAPGKEYEFIIECKYIDMFKGIFA FILYFWTFVTVYDSFSGILRKGRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-100 1x 100 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-100 1x 100 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-500 1x 500 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-100 1x 100 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details