Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein B0310.3 (B0310.3)

This Recombinant Uncharacterized protein B0310.3 (B0310.3) spans the amino acid sequence from region 1-445.

Product Specifications

Product Name Alternative

Uncharacterized protein B0310.3

UniProt

Q10939

Expression Region

1-445

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIKCMFPAVNILKFLYTHTPRSFLFILDEKKFSNQMEGNFLNNPWINCCFVTTYAGVVA QYFKKGAEWFNFTTPSIGTFTNEQNEEDSSNYSTSGYDSSAETISANSSPINRSGVRSRI SQKQRQRILKEAHFKAQQLNRKMVVQKSCPPDHEIKPVPSKFYQFDAITDFGFGGPVLLV GMQKDVEVMKLETKEKARSGRKKNRKSKYKCNMYKMTKLAQIVAKIPKKKEVIEIDEDGF QKVSSKKAAKLRTLKPADVPTPPTKVVENKEEVIKLEVIEQPEPIVLPVSTPTVTFSRFE EMKRVVKVEKAQESAKTKALKKSKAISISRHVGFLQILEKLEETEEKPQVENEKKVVVKH VQSARKNQKKGRKNRKVEPPKEEFEPYEEDHYNFKRYFLIIGVYVLVFIYVCTNVLTVGV SYEFPYITLANKSEKNWDSLFSKCV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIMAP4 (GTPase IMAP Family Member 4, Immunity-associated Nucleotide 1 Protein, IAN-1, hIAN1, Immunity-associated Protein 4, FLJ11110, IAN1, IMAP4, MSTP062) (MaxLight 650)
MBS6222353-01 0.1 mL

GIMAP4 (GTPase IMAP Family Member 4, Immunity-associated Nucleotide 1 Protein, IAN-1, hIAN1, Immunity-associated Protein 4, FLJ11110, IAN1, IMAP4, MSTP062) (MaxLight 650)

Sign In for Pricing
View Details
GIMAP4 (GTPase IMAP Family Member 4, Immunity-associated Nucleotide 1 Protein, IAN-1, hIAN1, Immunity-associated Protein 4, FLJ11110, IAN1, IMAP4, MSTP062) (MaxLight 650)
MBS6222353-02 5x 0.1 mL

GIMAP4 (GTPase IMAP Family Member 4, Immunity-associated Nucleotide 1 Protein, IAN-1, hIAN1, Immunity-associated Protein 4, FLJ11110, IAN1, IMAP4, MSTP062) (MaxLight 650)

Sign In for Pricing
View Details
1- (Thiophen-3-yl) -2-azaspiro[3.3]heptane hydrochloride
FDD51996-01 50 mg

1- (Thiophen-3-yl) -2-azaspiro[3.3]heptane hydrochloride

Sign In for Pricing
View Details
1- (Thiophen-3-yl) -2-azaspiro[3.3]heptane hydrochloride
FDD51996-02 0.5 g

1- (Thiophen-3-yl) -2-azaspiro[3.3]heptane hydrochloride

Sign In for Pricing
View Details
Spop (NM_001100496) Rat Tagged Lenti ORF Clone
RR203648L3 10 µg

Spop (NM_001100496) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tufm 3'UTR Lenti-reporter-Luc Vector
48836084 1.0 µg

Tufm 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details