Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus oryzae Mitochondrial import inner membrane translocase subunit tim54 (tim54)

This Recombinant Aspergillus oryzae Mitochondrial import inner membrane translocase subunit tim54 (tim54) spans the amino acid sequence from region 1-445.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit tim54

UniProt

Q2UJY4

Expression Region

1-445

Origin

Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPNFRLKLPSRNWMIFLTVTGSFTAALVYDRKQKKRAQQKWCDLVAHLSKESLPVDQTRR KLTVFLSAPPGDGLRVAREHFKEYVKPILVAAALDYQVIEGRREGEIRAGLAERIRKFRR KSGEPSTVVEETGIEEVVADAREKIGVVEEPVPKGDLIIGRNTWKEYIRGLHEGWLGPLD PPQPPLSTDVPSPSEGAETNGSPDDTPTAENSEKKEEPEKKDEKPSKPTGPTPAYITPAD YSSQSLPRSLPQSLDGSVPIQFPHILGFLNTPIRIYRYLNQRYLADSVGREVAGIVLAST TRPYSDGSFSTDSELTPAGIDGAPASDNLLGGNYEQKTLLEEEEKDWHKSAHKKDEANPD KEREWVDSVVLDPRIAARMQRYVLSPEDEARSQRIAEGAEYILGEERPTPVPFWQRMWIK YGYGEDEETLKRKPIIGNIDGEDDQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GenePure Pro Nucleic Acid Purification System
BYF6A29E 1 Unit

GenePure Pro Nucleic Acid Purification System

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 8b (CD8b)
MBS2084798-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 8b (CD8b)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 8b (CD8b)
MBS2084798-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 8b (CD8b)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 8b (CD8b)
MBS2084798-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 8b (CD8b)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 8b (CD8b)
MBS2084798-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 8b (CD8b)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 8b (CD8b)
MBS2084798-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Cluster Of Differentiation 8b (CD8b)

Sign In for Pricing
View Details