Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized protein C405.02c (SPBC405.02c)

This Recombinant Schizosaccharomyces pombe Uncharacterized protein C405.02c (SPBC405.02c) spans the amino acid sequence from region 1-447.

Product Specifications

Product Name Alternative

Uncharacterized protein C405.02c

UniProt

Q9UUM6

Expression Region

1-447

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFENLGGHAQRRDESAYRLGEEDGRQKGESSRKKRPPLSRKNPSNVSFWSNEPIIRHSS VKTDRPQFHRADSTVTEQSSEILFDGNAESAEPLSKRSPPFLAYTPKRAVSATLATTQSS PISTSFNPQLPSNSNTNRFDFGSESQLSSNYTNDTGLSLLSLPKSVPHSPAMHKRTPSSD PNNPFGSTFANKFLDHIPAEPLPLPARPQISDLSFFRKPSLPSALQNIVIEKNASQRSVS EPLHNLSSRYSHFTSPHIDDSQHFPPMEFFARSDELPNPFVPFFDLDSKPNLSTLQDNAS LTSQGSNLSSQNSGLSSSSSGIFGRMPIPAQSLDTTMLRTDSNSNIRRATTSFIANSEKE NSSNFIDPQKYASIKFKNGNGVSKFMFLFTFGIVFPPLWILASFLPIPRTKIHQMRVKHV HWRIINRVVACLGVAITFLFIGLGVSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-500 1x 500 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
BNC700391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details