Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

This Recombinant Candida glabrata Mitochondrial import inner membrane translocase subunit TIM50 (TIM50) spans the amino acid sequence from region 36-485.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM50

UniProt

Q6FRX4

Expression Region

36-485

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NKRRLNTKSYFLQEQKKDDKKAQSILTDDLLFKAGIDVEEGKKEGQQKQHETEEGNEEQQ SENSSNKKRKRRMTSADKKKERYANYFYIFTFSSLAGLGLYMCRDWEENEDDEMKKDIDN GYTPDLMYKRFRARFNSVFTYFQEPPFPDLLPPPPPAPYQRPLTLVITLEDFLVHSEWDQ KHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMDPIHAFISYNLFKEHCV YKDGVHIKDLSKLNRDLKKVMIIDTDENSYKLQPENAIPMDPWDGKADDKLLRLIPFLEY MATQQVEDVRPILKSYHNKRELPAEFEQRVQKLKNKFEQDQKKKNDSNWLLKLLGLAPVI NGIGGGNKFPLDMIREEGEKNYVRFMKLIEEEKEKMRIQQEQMSGQTFTLKDYVEGNIPT PEEQMKMQLEKQKEIDALFEQKKKEQQANK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP51 (NM_201286) Human Over-expression Lysate
E45H16478-2 20 µg

USP51 (NM_201286) Human Over-expression Lysate

Sign In for Pricing
View Details
STAT3-IN-1 1mg
A12232-1 1 mg

STAT3-IN-1 1mg

Sign In for Pricing
View Details
Lentiviral human REXO2 sgRNA gene knockout kit - Lentiviral human REXO2 sgRNA gene knockout kit (plasmid)
GTR15359441 1 Vial

Lentiviral human REXO2 sgRNA gene knockout kit - Lentiviral human REXO2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
CLDN4 Protein
OPPA00113-2UG 2 µg

CLDN4 Protein

Sign In for Pricing
View Details
GABPB1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
21149066 1.0 µg DNA

GABPB1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Whale Progesterone (PROG) ELISA Kit
orb1655341-01 48 Tests

Whale Progesterone (PROG) ELISA Kit

Sign In for Pricing
View Details