Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative L, D-transpeptidase Mb0493 (Mb0493)

This Recombinant Putative L, D-transpeptidase Mb0493 (Mb0493) spans the amino acid sequence from region 1-451.

Product Specifications

Product Name Alternative

Putative L, D-transpeptidase Mb0493, EC= 2.-.-.-

UniProt

P64704

Expression Region

1-451

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVIRVLFRPVSLIPVNNSSTPQSQGPISRRLALTALGFGVLAPNVLVACAGKVTKLAEKR PPPAPRLTFRPADSAADVVPIAPISVEVGDGWFQRVALTNSAGKVVAGAYSRDRTIYTIT EPLGYDTTYTWSGSAVGHDGKAVPVAGKFTTVAPVKTINAGFQLADGQTVGIAAPVIIQF DSPISDKAAVERALTVTTDPPVEGGWAWLPDEAQGARVHWRPREYYPAGTTVDVDAKLYG LPFGDGAYGAQDMSLHFQIGRRQVVKAEVSSHRIQVVTDAGVIMDFPCSYGEADLARNVT RNGIHVVTEKYSDFYMSNPAAGYSHIHERWAVRISNNGEFIHANPMSAGAQGNSNVTNGC INLSTENAEQYYRSAVYGDPVEVTGSSIQLSYADGDIWDWAVDWDTWVSMSALPPPAAKP AATQIPVTAPVTPSDAPTPSGTPTTTNGPGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MEK2 Antibody (OTI1A2) [DyLight 755]
NBP2-72647IR 0.1 mL

Mouse Monoclonal MEK2 Antibody (OTI1A2) [DyLight 755]

Sign In for Pricing
View Details
VTI1A Antibody
OACA10632-50UG 50 µg

VTI1A Antibody

Sign In for Pricing
View Details
Polyclonal PDGF-BB Antibody
APR00412G 0.1mg

Polyclonal PDGF-BB Antibody

Sign In for Pricing
View Details
TCF7, NT (Transcription Factor 7, T-cell Specific Transcription Factor 1, T-cell Factor 1, TCF-7, TCF-1, TCF1) (PE)
MBS6503300-01 0.2 mL

TCF7, NT (Transcription Factor 7, T-cell Specific Transcription Factor 1, T-cell Factor 1, TCF-7, TCF-1, TCF1) (PE)

Sign In for Pricing
View Details
TCF7, NT (Transcription Factor 7, T-cell Specific Transcription Factor 1, T-cell Factor 1, TCF-7, TCF-1, TCF1) (PE)
MBS6503300-02 5x 0.2 mL

TCF7, NT (Transcription Factor 7, T-cell Specific Transcription Factor 1, T-cell Factor 1, TCF-7, TCF-1, TCF1) (PE)

Sign In for Pricing
View Details
PLEKHF2 Antibody
A70221-100UL 100 µL

PLEKHF2 Antibody

Sign In for Pricing
View Details