Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lamina-associated polypeptide 2, isoform beta (Tmpo)

This Recombinant Rat Lamina-associated polypeptide 2, isoform beta (Tmpo) spans the amino acid sequence from region 2-452.

Product Specifications

Product Name Alternative

Lamina-associated polypeptide 2, isoform beta, Thymopoietin isoform beta, TP beta

UniProt

Q62733

Expression Region

2-452

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSKG PPDFSSDEEREPTPVLGSGASVGRGRGAVGRKATKKTDKPRPEDKDDLDVTELSNEELLE QLVRYGVNPGPIVGTTRKLYEKKLLKLREQGAESRSSTPLPTVSSSAENTRQNGSNDSDR YSDNDEDSKIELKLEKREPLKGRAKTPVTLKQRRIEHNQSYSEAGVTETEWTSGSSKGGP LQALTRESTRGSRRTPRRRVEPSQHFRVDGAVISESTPIAETIKASSNDSLVANRLTGNF KHASSILPITEFSDITRRTPKKPLTRAEVGEKTEERRVERDILKEMFPYEASTPTGISAS CRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSVPMWIKMLLFAL VAGFLFLVYQAMETNQGNPFTNFLQDTKISN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbon Residue Tester (Micromethod) BPTL-259
BPTL-259 1 Unit

Carbon Residue Tester (Micromethod) BPTL-259

Sign In for Pricing
View Details
PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), Biotin conjugate, 0.1mg/mL
BNCB3065-100 1x 100 µL

PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFluor® 820 succinimidyl ester
1399-AAT 1 mg

IFluor® 820 succinimidyl ester

Sign In for Pricing
View Details
NID1 Antibody
8C17049-AAT 50 µg

NID1 Antibody

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), Biotin conjugate, 0.1mg/mL
BNCB2576-500 1x 500 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1481), Biotin conjugate, 0.1mg/mL
BNCB1481-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details