Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lamina-associated polypeptide 2, isoform beta (Tmpo)

This Recombinant Rat Lamina-associated polypeptide 2, isoform beta (Tmpo) spans the amino acid sequence from region 2-452.

Product Specifications

Product Name Alternative

Lamina-associated polypeptide 2, isoform beta, Thymopoietin isoform beta, TP beta

UniProt

Q62733

Expression Region

2-452

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSKG PPDFSSDEEREPTPVLGSGASVGRGRGAVGRKATKKTDKPRPEDKDDLDVTELSNEELLE QLVRYGVNPGPIVGTTRKLYEKKLLKLREQGAESRSSTPLPTVSSSAENTRQNGSNDSDR YSDNDEDSKIELKLEKREPLKGRAKTPVTLKQRRIEHNQSYSEAGVTETEWTSGSSKGGP LQALTRESTRGSRRTPRRRVEPSQHFRVDGAVISESTPIAETIKASSNDSLVANRLTGNF KHASSILPITEFSDITRRTPKKPLTRAEVGEKTEERRVERDILKEMFPYEASTPTGISAS CRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSVPMWIKMLLFAL VAGFLFLVYQAMETNQGNPFTNFLQDTKISN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRA1 Antibody, Biotin conjugated
CSB-PA308545YD01CZD-01 50 μL

PRA1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PRA1 Antibody, Biotin conjugated
CSB-PA308545YD01CZD-02 100 µL

PRA1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rat Protein WFDC9, WFDC9 ELISA Kit
MBS9321883-01 48 Well

Rat Protein WFDC9, WFDC9 ELISA Kit

Sign In for Pricing
View Details
Rat Protein WFDC9, WFDC9 ELISA Kit
MBS9321883-02 96 Well

Rat Protein WFDC9, WFDC9 ELISA Kit

Sign In for Pricing
View Details
Rat Protein WFDC9, WFDC9 ELISA Kit
MBS9321883-03 5x 96 Well

Rat Protein WFDC9, WFDC9 ELISA Kit

Sign In for Pricing
View Details
Rat Protein WFDC9, WFDC9 ELISA Kit
MBS9321883-04 10x 96 Well

Rat Protein WFDC9, WFDC9 ELISA Kit

Sign In for Pricing
View Details