Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 15 (KCS15)

This Recombinant Arabidopsis thaliana 3-ketoacyl-CoA synthase 15 (KCS15) spans the amino acid sequence from region 1-451.

Product Specifications

Product Name Alternative

3-ketoacyl-CoA synthase 15, KCS-15, EC= 2.3.1.-, Very long-chain fatty acid condensing enzyme 15, VLCFA condensing enzyme 15

UniProt

Q9SUY9

Expression Region

1-451

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKEATKMVNGGVKSKSPKGSPDFLGYNLRYVKLGYIYLLSLSRTFCFFLPPLLLLFIFV SRFLPILAFPLSTFFILLIYHYLTPSSVFLLDFSCYRPPDHLKITKSDFIELAMKSGNFN ETAIELQRKVLDQSGIGEESYMPRVVFKPGHRVNLRDGREEAAMVIFGAIDELLAATKIN VKHIKILVLNCGVLNTTPSLSAMVINHYKLRHNTESYNLGGMGCSAGVIAIDLAKDLLNA HQGSYALVVSTEIVSFTWYSGNDVALLPPNCFFRMGAAAVMLSSRRIDRWRAKYQLMQLV RTHKGMEDTSYKSIELREDRDGKQGLYVSRDVMEVGRHALKANIATLGRLEPSFEHICVL ASSKKVLDDIHKDLKLTEENMEASRRTLERFGNTSSSSIWYELAYLEHKAKMKRGDRVWQ IGFGSGFKCNSVVWKALKNIDPPRHNNPWNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-500 1x 500 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-100 1x 100 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
BNC741081-100 1x 100 µL

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-500 1x 500 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF740 conjugate, 0.1mg/mL
BNC740322-500 1x 500 µL

CD3e (RIV9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-100 1x 100 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details