Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yukC (yukC)

This Recombinant Bacillus subtilis Uncharacterized protein yukC (yukC) spans the amino acid sequence from region 1-451.

Product Specifications

Product Name Alternative

Uncharacterized protein yukC

UniProt

P71070

Expression Region

1-451

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGEQKSYLENQLEAVAEKTDAGYTFTFQREKIKLLDGLEANVIKDINPFFHKEIDVTDD EVIITIQPPSSYKAFRFMKAKDKKSKWQFAYQLVQAVQQHNLSRLNLIVAPENIVFDKGL TPYFLHYGVKESIPPYERDEERVWQELKAAAALAVDGAFAFEDYLKFNETLTFSAEAKAI LDAESYDDLLELIQTHIDELEAKAKTYIHIPRKKWNIQRYIGLGLIVLLVPALIYSMYAL FFAQPKHQAIVDSNRAFLNKQYSEVISTLSKYDAESLPESVQYQLATSYVEVENLGSAKT KNIENNLVTLQSDPQHFLYWIDYGRGEYKEAISIGRKLEYNDYIYFALAKYKQQLLSEDT NDEDIQKELDSVNSELEKAQKERQENKQSNSETSLVDTSEEQTQTDEEKQAEEKAAEEKA AAEEKAKKEEQKEKEDEKKETEKKDEKKDDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PsmAB ELISA Kit
EMP0738 96 Tests

Mouse PsmAB ELISA Kit

Sign In for Pricing
View Details
ZFPL1 Rabbit Polyclonal Antibody (AP)
orb957796 100 µL

ZFPL1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Recombinant Human GOLGA3 Protein
E30P7675 20 µg

Recombinant Human GOLGA3 Protein

Sign In for Pricing
View Details
CCNB2 Antibody
MBS9401666-01 0.1 mL

CCNB2 Antibody

Sign In for Pricing
View Details
CCNB2 Antibody
MBS9401666-02 5x 0.1 mL

CCNB2 Antibody

Sign In for Pricing
View Details
TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) discontinued
T9176-03A 50 µg

TSC22D3 (TSC22 domain family protein 3, Glucocorticoid-induced leucine zipper protein, Delta sleep-inducing peptide immunoreactor, DSIP-immunoreactive Peptide, Protein DIP, TSC-22-like Protein, TSC-22-related Protein, TSC-22R, DSIPI, GILZ) discontinued

Sign In for Pricing
View Details