Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

This Recombinant Candida glabrata Mitochondrial import inner membrane translocase subunit TIM54 (TIM54) spans the amino acid sequence from region 1-452.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM54

UniProt

Q6FPC0

Expression Region

1-452

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPALKALGLGNFKLPSRNWTIFWTVLAGSLGGVGYDKYQQRQIISRYCDEVKPLSLQHC DVNKSPRKITVFIAPPPNDYLETSLKIWRRYIKPVLYYAGLDYEVIEEDRQGIIRSEVAS RIRQLRRELLEADNEQQGNSGDSLLSIFKKPHAKDPEEEQKFDPEQARQFKADFDFRNVM GIYTKVPKLDTIVQTDSLVADPVLAGGVVCVGRGAYKEYITGLHEGLLGPLDPPEETTQE VEMGSKLKSMNDGDNVETTVETAVETMVETTLESADKVEVEGKDTENEEGKDEPDEEKSR VLKPYLLRTAFHDTPIPPEVEPVLEKDALLKDPKTNVPSLLHQPVLVIPVPNLIGFLTIP ERIYRFYQRRFFVDEVCREASNLVKQEHIVKYEPDKHINLALEEESDWPKQWVKTGIEKN SEWTQELVQDQRVVSKMHVFELPKHTTKDTKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-500 1x 500 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-100 1x 100 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-500 1x 500 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF405S conjugate, 0.1mg/mL
BNC042103-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (ZAP70/528), CF640R conjugate, 0.1mg/mL
BNC400528-500 1x 500 µL

ZAP70 (ZAP70/528), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details