Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Autophagy-related protein 32 (ATG32)

This Recombinant Ashbya gossypii Autophagy-related protein 32 (ATG32) spans the amino acid sequence from region 1-452.

Product Specifications

Product Name Alternative

Autophagy-related protein 32

UniProt

Q753M9

Expression Region

1-452

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTKSQVTRRVRTSIATPEDGVHGNNQHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMT VGKRRVERSLHHSISESWQAIKRSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEMRPS AHGTVHLGSSLASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEP QLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDG LCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEKHRLLKHLHNL CNESESGYETELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIGCCISLMATTR FTFFSSAPLPLTAVIPAQIPSSVASDKPPHRLVPHFYMLCKTTIRQLGTSLRLFFFEKFE SRTWVHIFGMDLHSDDPLASLGRLMPLDFIML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-100 1x 100 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-500 1x 500 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-500 1x 500 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF405S conjugate, 0.1mg/mL
BNC040252-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details