Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechocystis sp. Putative serine protease HtrA (htrA)

This Recombinant Synechocystis sp. Putative serine protease HtrA (htrA) spans the amino acid sequence from region 1-452.

Product Specifications

Product Name Alternative

Putative serine protease HtrA

UniProt

P73354

Expression Region

1-452

Origin

Synechocystis sp. (strain PCC 6803 / Kazusa)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAQAVFPIAPHRADFFPRFVLSNSSANKCHQAMKDVSLHSPKQTPSKISLAYLGLVLVG MGIGAGGTFVLTNPQWADHLTNNSVISPLVTNQSIAPANESLATNLQSRLSPREPSNFVV DVVESTGPAVVRINAQKTVKSQVPQAFNDPFLQRFFGSQMPPMPNERVQRGTGSGFIVSN DGKIFTNAHVVDGADEVTVTLKDGRSFPGRVMGSDPSTDVAVVKIEAGDLPTVALGDSDH LQVGEWAIAIGNPLGLDNTVTTGILSATGRRSADIGVPDKRVEFIQTDAAINPGNSGGPL LNADGQVIGMNTAIIQNAQGIGFAIPINKAQEIAQQLIATGKVEHAYLGIQMVTMTPELQ SQIRQETGMNIPVDKGVVIMQVMPNSPAAIAKLEQGDVLQSLQGQPVENAEQVQSLVGKL AVGDEVELGILRNGQQQNLTVTIGALPSAPPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPA34 (RPA2) Rabbit Polyclonal Antibody
TA369326 100 µL

RPA34 (RPA2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL32 (1-131) Mouse Monoclonal Antibody [Clone ID: AT2F9]
AM09356PU-S 50 µL

IL32 (1-131) Mouse Monoclonal Antibody [Clone ID: AT2F9]

Sign In for Pricing
View Details
Her2 (ERBB2) pTyr1248 Rabbit Polyclonal Antibody
AP20949PU-N 100 µg

Her2 (ERBB2) pTyr1248 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EBAG9 Human Gene Knockout Kit (CRISPR)
KN205364 1 Kit

EBAG9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR562047 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Arhgef38 Mouse Gene Knockout Kit (CRISPR)
KN501539 1 Kit

Arhgef38 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details