Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

This Recombinant Ustilago maydis Mitochondrial import inner membrane translocase subunit TIM50 (TIM50) spans the amino acid sequence from region 40-493.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM50

UniProt

Q4PEW9

Expression Region

40-493

Origin

Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATPSSSSKPPPPSPSGSPASSKPAKAESTDDAQSQPQPQPPAEPELARKGSSLFDIDTSA TPLASQLIEAEEAASRSDAGKGSTRAKAKTGARSMSSIERRRQNTVRILTGFVLIGAGLS AYKLGRPWESSAEAERFADSADAQTFVGRIKLRLNAMYDDYNKPLFEQLLPDPLPFPYSR PFTMVIDIDDLLVHSEWSREHGWRTAKRPGLDHFLGYLSQFYEIVLFTTQPFFTAGPIIE KLDPDRRFITYTLFRESCRTVDGKLVKDLNHLNRDLSKVVVVDTNPDSFHLHPENGILVK PWKGEREDRELIGLIPFFEAIGIYNIDDVRNTIKAYTGTHIPTEHARRTAAIRERELADN KARLERMGKFGSVFGRVSRSASAGLPADKTLYDLERERYLQAYLEEQKYWNENGDAIRKQ AKDEQDRQIREMKINTWGFFTGGLKPQQPETPAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-100 1x 100 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL
BNC040669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-100 1x 100 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/1097), CF488A conjugate, 0.1mg/mL
BNC881097-100 1x 100 µL

CD44 Standard (HCAM/1097), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details