Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

This Recombinant Ustilago maydis Mitochondrial import inner membrane translocase subunit TIM50 (TIM50) spans the amino acid sequence from region 40-493.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM50

UniProt

Q4PEW9

Expression Region

40-493

Origin

Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATPSSSSKPPPPSPSGSPASSKPAKAESTDDAQSQPQPQPPAEPELARKGSSLFDIDTSA TPLASQLIEAEEAASRSDAGKGSTRAKAKTGARSMSSIERRRQNTVRILTGFVLIGAGLS AYKLGRPWESSAEAERFADSADAQTFVGRIKLRLNAMYDDYNKPLFEQLLPDPLPFPYSR PFTMVIDIDDLLVHSEWSREHGWRTAKRPGLDHFLGYLSQFYEIVLFTTQPFFTAGPIIE KLDPDRRFITYTLFRESCRTVDGKLVKDLNHLNRDLSKVVVVDTNPDSFHLHPENGILVK PWKGEREDRELIGLIPFFEAIGIYNIDDVRNTIKAYTGTHIPTEHARRTAAIRERELADN KARLERMGKFGSVFGRVSRSASAGLPADKTLYDLERERYLQAYLEEQKYWNENGDAIRKQ AKDEQDRQIREMKINTWGFFTGGLKPQQPETPAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (2-Ethoxyphenyl) piperazine monohydrochloride
sc-222471A 100 g

1- (2-Ethoxyphenyl) piperazine monohydrochloride

Sign In for Pricing
View Details
Fish Lipoprotein Lipase (LPL) ELISA Kit-Sandwich
EK11F373-01 48 Test

Fish Lipoprotein Lipase (LPL) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Fish Lipoprotein Lipase (LPL) ELISA Kit-Sandwich
EK11F373-02 96 Tests

Fish Lipoprotein Lipase (LPL) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Olr1710 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
34161116 3x 1.0 µg

Olr1710 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Edoxaban Impurity 62
RM-E042862-01 10 mg

Edoxaban Impurity 62

Sign In for Pricing
View Details
Edoxaban Impurity 62
RM-E042862-02 25 mg

Edoxaban Impurity 62

Sign In for Pricing
View Details