Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 067R (IIV6-067R)

This Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 067R (IIV6-067R) spans the amino acid sequence from region 1-456.

Product Specifications

Product Name Alternative

Uncharacterized protein 067R

UniProt

O55708

Expression Region

1-456

Origin

Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKTIIIRKIPPIDDFKRFVPKRFSRFPQLYLELLENKNKVKLNCIGKEFVPTTPPLSTGR ETIVSKDPHVVQSSISNTPIRTEIKDTPRYEETPIKRTITVTNVKTVKSSSISGMNGRNR LYDDDLFDDDRYKSPTTRKFQGEKRDEDIRLIPKSSNIGSSKYKPVLTRVEENENKKIHI DQRKESIVNDERKKNPEFREKPDKNEDKKVKPPPSLKEIENKGIDHEENEEDKKRELMFK LQLLQKQYPLRDIPDFTIRSEYKSMKKTYDIIVKQLSVDSSVETYKNYLVGGFMVCEMVF GRIGFDMEGFTQQQLLSMNSYEKLLLELGEKTYTPAGMDKWPVEVRLALAILFNAVWFIA AKMIMKKTKINILSLFNNTKGLNKSGTTPNSVSPRTWGNSKSPQSEFNFIGRKNENNSVG RTQMKGPSINRIDEGFGSESDESRREMREQGIETLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-500 1x 500 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
BNC402848-500 1x 500 µL

Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (rB22.1), CF640R conjugate, 0.1mg/mL
BNC402175-500 1x 500 µL

Cytokeratin 8 (KRT8) (rB22.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details