Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Heme sensor protein hssS (hssS)

This Recombinant Staphylococcus haemolyticus Heme sensor protein hssS (hssS) spans the amino acid sequence from region 1-456.

Product Specifications

Product Name Alternative

Heme sensor protein hssS, EC= 2.7.13.3

UniProt

Q4L8M0

Expression Region

1-456

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKTLYTRIAIYTITVILFSALVSFLFANVYYHFNLKAHNDAKIMRTLKEARAFHTSSNQ SDTQSYFKHLGDMNYQIMIVDHSYHKTFFGEPFRKDTISDSAINQVLKGKAYHGIKNKPF ELFITGFFDNETDNTVGIPFNQNNQKLAVFMRPDIGETFSEFRTFLAVLLICLLGISITL VIASTYSIIKPIKILKQATERLMHGDFNSPIYQSRHDEIGTLQYRFEAMRQSLKQVDDMR QHFVQNVSHEIKTPLTHIHRLLSTLQSNVNQGERDQIIHEIHEEVTHLSNLTKELLLLSE LDNATHLKFEDDVHFKELITDIIRHEQYGIDNKQLMLMSDIDTVHFRGNNRLLHQACSNL IQNAIKYSNPNSMIDVNLFNNEGTIYFTVTNEGHTIPESVQPHLFDRFYKRNAEDNSNGL GLAITQSIIHLHRGQISVTSNDRDGTTFTVTLPETN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABHD4 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-7948R-BF350 100 µL

ABHD4 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
LIPC Antibody, FITC Conjugated
MBS7113128-01 0.05 mg

LIPC Antibody, FITC Conjugated

Sign In for Pricing
View Details
LIPC Antibody, FITC Conjugated
MBS7113128-02 0.1 mg

LIPC Antibody, FITC Conjugated

Sign In for Pricing
View Details
LIPC Antibody, FITC Conjugated
MBS7113128-03 5x 0.1 mg

LIPC Antibody, FITC Conjugated

Sign In for Pricing
View Details
Bax (Apoptosis Regulator BAX Cytoplasmic Isoform beta, Apoptosis Regulator BAX Membrane isoform alpha, Bax isoform psi, Bax Protein cytoplasmic isoform delta, Bax Protein Cytoplasmic isoform gamma, Bax zeta, Bcl-2-like Protein 4, BCL2 Associated X Protein, BCL2 Associated X Protein omega, BCL2 Associated X Protein Transcript Variant delta2, BCL2L4) (AP) discontinued
172030-AF-AP 100 µL

Bax (Apoptosis Regulator BAX Cytoplasmic Isoform beta, Apoptosis Regulator BAX Membrane isoform alpha, Bax isoform psi, Bax Protein cytoplasmic isoform delta, Bax Protein Cytoplasmic isoform gamma, Bax zeta, Bcl-2-like Protein 4, BCL2 Associated X Protein, BCL2 Associated X Protein omega, BCL2 Associated X Protein Transcript Variant delta2, BCL2L4) (AP) discontinued

Sign In for Pricing
View Details
GET4 (1-327, His-tag) Human Protein
AR51379PU-S 100 µg

GET4 (1-327, His-tag) Human Protein

Sign In for Pricing
View Details