Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Mitochondrial inner membrane magnesium transporter mrs2 (MRS2)

This Recombinant Debaryomyces hansenii Mitochondrial inner membrane magnesium transporter mrs2 (MRS2) spans the amino acid sequence from region 21-476.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane magnesium transporter mrs2, RNA-splicing protein MRS2

UniProt

Q6BX67

Expression Region

21-476

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSGLSKQFFKYKSTVSRNQDILKKITDTNTHAMNTADIPEGISESFVDHQFEPNKLVPTN DKKIIYNRLKPITPNDSYVSCTIFDIKGNITAVSRKYPKMKFLKGNDLFPRDLRKIDTSS IDVVPSIMVRSPNCILVNLLHIKAIIKKDSVMVFDTSTPSIATKLGLFMYDLEMKLKLPS GNICYEFRALESILISVMSYLEADLRNHLQGCGLILAELEDEIDRNKLQDLLIKSKKLSS FYQKAVLIRNVLEELLDNDEDLAGMYLTDPIKFDPTIENPTDFADLEMMLESYYKQCDEF VQQAGSLINDIKATEEIVNIILDTNRNSLMLFELKITVYTLGFTVATLLPAFYGMNLKNY IEESTFGFGAVAVFSIIQGLLIIMLSFRKLRKVQKLTMMDGAGNHLHHSSSPIGLMNKDK WYYRLFYGNRHTKYDRPTPKESDVIWRMINDDKPLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aggrecan (ACAN) Rabbit Monoclonal Antibody
TA423103 100 µL

Aggrecan (ACAN) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
4-(4-Boc-piperazine-1-carbonyl)phenylboronic acid pinacol ester
TRC-B663198-500MG 500 mg

4-(4-Boc-piperazine-1-carbonyl)phenylboronic acid pinacol ester

Sign In for Pricing
View Details
Lactoylglutathione Lyase (CPTC-GLO1-1), CF640R conjugate, 0.1mg/mL
BNC402258-500 1x 500 µL

Lactoylglutathione Lyase (CPTC-GLO1-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF594 conjugate, 0.1mg/mL
BNC941999-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CNTN1 (Contactin 1) CLIA Kit
E-CL-H0966-01 24 Tests

Human CNTN1 (Contactin 1) CLIA Kit

Sign In for Pricing
View Details
Human CNTN1 (Contactin 1) CLIA Kit
E-CL-H0966-02 48 Tests

Human CNTN1 (Contactin 1) CLIA Kit

Sign In for Pricing
View Details