Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transmembrane protein 143 (TMEM143)

This Recombinant Bovine Transmembrane protein 143 (TMEM143) spans the amino acid sequence from region 1-457.

Product Specifications

Product Name Alternative

Transmembrane protein 143

UniProt

Q32PH2

Expression Region

1-457

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHVTRGVWGSIVRVWPLLPSFLGHSRALSSLEAKMGEYRKMWNPTEPRDWAQQYRERHI PFSKEQLLRLLIQEFHSTPAEKAALEEFTAHVDFCTLFHYHHVLTQLQALYDPINPDRET LDQPSLTDPQRLSNEKEVLQALEPLLAQANFSPLTEDTLAYALVVHHPQDEVQVTINLDQ YIYMHFWALGQRVGKMPRKSSVGSKRFFFKSPPAERRYFKRVILAARTKKGHLVLKSFKD TPLEGLEQLLPELKVRTSTLQRAILNVTLIVSGVVFFVNVGMVVLSDLKMATSLLLLLFA AFMGLRAAKMFGHRRSAQALELAHMLYYRSTSNNAELLSALVLRAQDEHTKETLLAHSFL ARRPGGAKGPPEETSQWLQSEVENWLLAQSGCDVAFNGKRALAHLQALPPTVGMYPPPGL PKLDLLATLSSPKSAPSDDNSLEKPLGPAQPSHLVGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-100 1x 100 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-500 1x 500 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-500 1x 500 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-500 1x 500 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details