Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse GRAM domain-containing protein 1C (Gramd1c)

This Recombinant Mouse GRAM domain-containing protein 1C (Gramd1c) spans the amino acid sequence from region 1-457.

Product Specifications

Product Name Alternative

GRAM domain-containing protein 1C

UniProt

Q8CI52

Expression Region

1-457

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHLLSVEENVQPRSPGRSSVDDAGERDEKFSKAVSFTQESVSRASETEPLDGNSPKRGL GKEDSQSERNVRKSPSLASEKRISRAPSKSLDLNKNEYLSLDKSSTSDSVDEENIPEKDL QGRLYINRVFHISAERMFELLFTSSHFMQRFANSRNIIDVVSTPWTVESGGNQLRTMTYT IVLSNPLTGKYTAATEKQTLYKESREAQFYLVDSEVLTHDVPYHDYFYTLNRYCIVRSAK QRCRLRVSTDLKYRKQPWGLIKSLIEKNSWSSLESYFKKLESDLLMEESVLSQSIEDAGK HSSLRRRRRTLNRTAEPVPKLSSQRSSTDLGFEAKVDVTGKRKTVDSYDTALIVVMSIFL LLLVLLNVTLFLKLSKIEHATQSFYQLHLQGEKSLNLVSDRFSRTENIQKNKDQAHRLKG VLQDSIVMLEQLKSSLIMLQKTFDLLNKNKSGVAVES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Rectum Paraffin Sections
HP-312 10 Slides

Human Rectum Paraffin Sections

Sign In for Pricing
View Details
Absolute Mag™ Carboxyl Magnetic Particles, 1.0-1.4 μm
WHM-S028 10 mL

Absolute Mag™ Carboxyl Magnetic Particles, 1.0-1.4 μm

Sign In for Pricing
View Details
ATIC antibody
70R-15891 50 μL

ATIC antibody

Sign In for Pricing
View Details
ADO Polyclonal Antibody, HRP Conjugated
A70076-100 100 µL

ADO Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
SIX4 (Sine Oculis Homeobox Homolog 4, Homeobox Protein SIX4, AREC3) (Biotin)
MBS6144373-01 0.1 mL

SIX4 (Sine Oculis Homeobox Homolog 4, Homeobox Protein SIX4, AREC3) (Biotin)

Sign In for Pricing
View Details
SIX4 (Sine Oculis Homeobox Homolog 4, Homeobox Protein SIX4, AREC3) (Biotin)
MBS6144373-02 5x 0.1 mL

SIX4 (Sine Oculis Homeobox Homolog 4, Homeobox Protein SIX4, AREC3) (Biotin)

Sign In for Pricing
View Details