Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Probable mitochondrial chaperone BCS1-B (bcsl1b)

This Recombinant Dictyostelium discoideum Probable mitochondrial chaperone BCS1-B (bcsl1b) spans the amino acid sequence from region 1-458.

Product Specifications

Product Name Alternative

Probable mitochondrial chaperone BCS1-B, BCS1-like protein 2

UniProt

Q54DY9

Expression Region

1-458

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENVITNNNKGLPKSILKFIPEPIQPLFENPFFSAGFGLIGVGSILAMGRKGFQQAMIQS RRYFFVSVEVPSKDKSFHWLMEWLATKKNKNTRHVSVETTFHQHESGDIVSRINFVPSVG THYVFYRGRVIKVERSREKNVIDMNSGNLWESITLTTLGTGRQVFQNLIEEAKEMALEKE EGKTLIYTSMGTDWRRFGHPRRKRPISSVILDKGKSELIIQDVKKFLNNSDWYNDRGIPY RRGYLLYGPPGTGKSSFITALAGELQLSICILNLAGKSVSDTSLNQLLATAPQRSIILLE DIDSAIQTGNHDLSAKSNSANAPSISSGGLQYQGYYGNPSVSSGGSALTFSGLLNALDGV AASEGRILFMTTNHLEKLDKVLIRPGRVDLQIEIGLCSSYQMEQMFLKFYPTDFDLAKQF VEKLENYKFSPAQLQAYFMTYSNNSIEAINNLNELIKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-100 1x 100 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-100 1x 100 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details