Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis Acyl-CoA-binding domain-containing protein 5 (acbd5)

This Recombinant Xenopus tropicalis Acyl-CoA-binding domain-containing protein 5 (acbd5) spans the amino acid sequence from region 1-458.

Product Specifications

Product Name Alternative

Acyl-CoA-binding domain-containing protein 5

UniProt

Q640U0

Expression Region

1-458

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADTKPLHQTRFEAAVSVIQSLPKNGSFQPSNEMMLKFYSFYKQATLGPCNTPRPGFWDP VGRYKWDAWNSLGDMSKEDAMIAYVDEMKKILETMPVTEKVEELLQVIGPFYEIVEDKKH GRGSGVTSELGSVLTSTPNGKAVNGKAESSDSGAESDEEQAATKEVREEDEEEESEHSEQ EDKDVEQQPGHEKPAESIVNGLTRNHRELVTEEPTPLPSKCLSEPGDKVAIPDTHSPVND PEADREEDCTEDIAAMQHLTSDSDSEIFCDSMEQFGQDEADHSLLLQDAMLNGDITETSA GGELKDGGEDGKQSGHGAQRKTWSEKSEHFGSRRERPSRMQPGGDGSRSGQIGSGGDGDR WGSDRGPNGSLNEQIAVVLMRLQEDMQNVLQRLHSLEVQTASQAQFLLRESNNQPMEKKP SRWPFGISPGTLALAVVWPFVVHWLMHVFLQKRRRKQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL
BNC740679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-100 1x 100 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details