Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

This Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM54 (TIM54) spans the amino acid sequence from region 1-458.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM54

UniProt

P0CR90

Expression Region

1-458

Origin

Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADLTPGARKPAPAELTGFRSALAHTGIPHGVLLWKPRLPSRNWLVFWSVSLSLSYAYYY DRAECKRIKQEVVERVEKYGREPMPGGSLGEPRRVVVWAGRWGGDDDADRAGRYFRKYVK PYLVAAGIDYTLPSVPLHGSITRQLHAAILLQRRQALGLAPTATPLSLPGVLDPAEAKRR EVESGVVVVGRASLKEYLEGLRRGWECGVDEWAWETEVEKTLAGDGVFESVESPVEPAVE TAETVVEPTADAVPKSNFGFLARPAPVTPGAPAIPAHLHTPPSPLPPTPPLLLLPFTNHL GFLQLPYMILDFFNERAKVRQGAQSALALIEGPTRDMHREDAEHWEEKSESWYNKTARQL PERLQKSRTEYYEAIKSRIDLARAYENGDREMTEEEKKANKVERIQDIQAERLKKELRWK GSEEGWEIVKPETPATWRDRWEGWLKVYQVPEDAQKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aggrecan (Proteoglycan, PG, AGC 1, Aggrecan 1, Antigen identified by monoclonal A0122, Cartilage specific proteoglycan core protein, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1, CSPGCP, Large aggregating proteoglycan, MSK16, SEDK) (MaxLight 490) discontinued
A1059-53C-ML490 100 µL

Aggrecan (Proteoglycan, PG, AGC 1, Aggrecan 1, Antigen identified by monoclonal A0122, Cartilage specific proteoglycan core protein, Chondroitin sulfate proteoglycan core protein 1, CSPCP, CSPG1, CSPGCP, Large aggregating proteoglycan, MSK16, SEDK) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Mouse Tropomyosin 3 (TPM3) ELISA Kit
orb781253-01 48 Tests

Mouse Tropomyosin 3 (TPM3) ELISA Kit

Sign In for Pricing
View Details
Mouse Tropomyosin 3 (TPM3) ELISA Kit
orb781253-02 96 Tests

Mouse Tropomyosin 3 (TPM3) ELISA Kit

Sign In for Pricing
View Details
CR1L (NM_175710) Human Tagged ORF Clone Lentiviral Particle
RC217373L4V 200 µL

CR1L (NM_175710) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat Dipeptidyl Peptidase 3 (DPP3) ELISA Kit
abx514963 96 Tests

Rat Dipeptidyl Peptidase 3 (DPP3) ELISA Kit

Sign In for Pricing
View Details
PSMC1P13 ORF Vector (Human) (pORF)
ORF028458 1.0 µg DNA

PSMC1P13 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details