Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

This Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM54 (TIM54) spans the amino acid sequence from region 1-458.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM54

UniProt

P0CR91

Expression Region

1-458

Origin

Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADLTPGARKPAPAELTGFRSALAHTGIPHGVLLWKPRLPSRNWLVFWSVSLSLSYAYYY DRAECKRIKQEVVERVEKYGREPMPGGSLGEPRRVVVWAGRWGGDDDADRAGRYFRKYVK PYLVAAGIDYTLPSVPLHGSITRQLHAAILLQRRQALGLAPTATPLSLPGVLDPAEAKRR EVESGVVVVGRASLKEYLEGLRRGWECGVDEWAWETEVEKTLAGDGVFESVESPVEPAVE TAETVVEPTADAVPKSNFGFLARPAPVTPGAPAIPAHLHTPPSPLPPTPPLLLLPFTNHL GFLQLPYMILDFFNERAKVRQGAQSALALIEGPTRDMHREDAEHWEEKSESWYNKTARQL PERLQKSRTEYYEAIKSRIDLARAYENGDREMTEEEKKANKVERIQDIQAERLKKELRWK GSEEGWEIVKPETPATWRDRWEGWLKVYQVPEDAQKGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IKZF3 Mouse Monoclonal Antibody [Clone 1E1]
E45M16388V-2 50 µL

IKZF3 Mouse Monoclonal Antibody [Clone 1E1]

Sign In for Pricing
View Details
PbrPOE1 Rabbit pAb
A20403 20 µL

PbrPOE1 Rabbit pAb

Sign In for Pricing
View Details
RXRA Peptide (AAP45610)
AAP45610-100UG 100 µg

RXRA Peptide (AAP45610)

Sign In for Pricing
View Details
C16orf78 CRISPR Knock Out 293T Cell Line (Human)
13941141 1x 10^6 Cells / 1.0 mL

C16orf78 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Kallikrein 2 (KLK2) Goat Polyclonal Antibody
TA303201 100 µg

Kallikrein 2 (KLK2) Goat Polyclonal Antibody

Sign In for Pricing
View Details
FAM84A Double Nickase Plasmid (m2)
sc-430571-NIC-2 20 µg

FAM84A Double Nickase Plasmid (m2)

Sign In for Pricing
View Details