Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable elastin-binding protein ebpS (ebpS)

This Recombinant Staphylococcus epidermidis Probable elastin-binding protein ebpS (ebpS) spans the amino acid sequence from region 1-460.

Product Specifications

Product Name Alternative

Probable elastin-binding protein ebpS

UniProt

Q5HP65

Expression Region

1-460

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNNNFKDDFEKNRQSINPDEHQTELKEDDKTNENKKEADSQNSLSNNSNQQFPPRNAQR RKRRRETATNQSKQQDDKHQKNSDAKTTEGSLDDRYDEAQLQQQHDKSQQQNKTEKQSQD NRMKDGKDAAIVNGTSESPEHKSKSTQNRPGPKAQQQKRKSESTQSKPSTNKDKKAATGA GIAGAAGVAGAAETSKRHHNKKDKQDSKHSNHENDEKSVKNDDQKQSKKGKKAAVGAGAA AGVGAAGVAHHNNQNKHHNEEKNSNQNNQYNDQSEGKKKGGFMKILLPLIAAILILGAIA IFGGMALNNHNDSKSDDQKIANQSKKDSDKKDGAQSEDNKDKKSDSNKDKKSDSDKNADD DSDNSSSNPNATSTNNNDNVANNNSNYTNQNQQDNANQNSNNQQATQGQQSHTVYGQENL YRIAIQYYGEGTQANVDKIKRANGLSSNNIHNGQTLVIPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F115A (TCAF1) (NM_014719) Human Over-expression Lysate
LC415093 20 µg

F115A (TCAF1) (NM_014719) Human Over-expression Lysate

Sign In for Pricing
View Details
Tmem126a Mouse shRNA Lentiviral Particle (Locus ID 66271)
TL503575V 500 µL Each

Tmem126a Mouse shRNA Lentiviral Particle (Locus ID 66271)

Sign In for Pricing
View Details
ZNF426 Polyclonal Antibody, FITC Conjugated
bs-12219R-FITC 100 µL

ZNF426 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Sheep NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) ELISA Kit
AE32401SH-01 48 Tests

Sheep NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) ELISA Kit

Sign In for Pricing
View Details
Sheep NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) ELISA Kit
AE32401SH-02 96 Tests

Sheep NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) ELISA Kit

Sign In for Pricing
View Details
Scnn1b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6781008 1.0 µg DNA

Scnn1b sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details