Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable elastin-binding protein ebpS (ebpS)

This Recombinant Staphylococcus epidermidis Probable elastin-binding protein ebpS (ebpS) spans the amino acid sequence from region 1-460.

Product Specifications

Product Name Alternative

Probable elastin-binding protein ebpS

UniProt

Q8CP59

Expression Region

1-460

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNNNFKDDFEKNRQSINPDEQQTELKEDDKTNENKKEADSQNSLSNNSNQQFPPRNAQR RKRRRETATNQSKQQDDKHQKNSDAKTTEGSLDDRYDEAQLQQQHDKSQQQNKTEKQSQD NRMKDGKDAAIVNGTSESPEHKSKSTQNRPGPKAQQQKRKSESTQSKPSTNKDKKAATGA GIAGAAGVAGAAETSKRHHNKKDKQDSKHSNHENDEKSVKNDDQKQSKKGKKAAVGAGAA AGVGAAGVAHHNNQNKHHNEEKNSNQNNQYNDQSEGKKKGGFMKILLPLIAAILILGAIA IFGGMALNNHNDSKSDDQKIANQSKKDSDKKDGAQSEDNKDKKSDSNKDKKSDSDKNADD DSDNSSSNPNATSTNNNDNVANNNSNYTNQNQQDNANQNSNNQQATQGQQSHTVYGQENL YRIAIQYYGEGTQANVDKIKRANGLSSNNIHNGQTLVIPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Megalin,LRP2 ELISA KIT
JOT-EK7472Hu-01 48 Well

Human Megalin,LRP2 ELISA KIT

Sign In for Pricing
View Details
Human Megalin,LRP2 ELISA KIT
JOT-EK7472Hu-02 96 Well

Human Megalin,LRP2 ELISA KIT

Sign In for Pricing
View Details
Mouse Mast/Stem Cell Growth Factor Receptor ELISA Kit
MBS7256195-01 48 Well

Mouse Mast/Stem Cell Growth Factor Receptor ELISA Kit

Sign In for Pricing
View Details
Mouse Mast/Stem Cell Growth Factor Receptor ELISA Kit
MBS7256195-02 96 Well

Mouse Mast/Stem Cell Growth Factor Receptor ELISA Kit

Sign In for Pricing
View Details
Mouse Mast/Stem Cell Growth Factor Receptor ELISA Kit
MBS7256195-03 5x 96 Well

Mouse Mast/Stem Cell Growth Factor Receptor ELISA Kit

Sign In for Pricing
View Details
Mouse Mast/Stem Cell Growth Factor Receptor ELISA Kit
MBS7256195-04 10x 96 Well

Mouse Mast/Stem Cell Growth Factor Receptor ELISA Kit

Sign In for Pricing
View Details