Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Probable elastin-binding protein ebpS (ebpS)

This Recombinant Staphylococcus epidermidis Probable elastin-binding protein ebpS (ebpS) spans the amino acid sequence from region 1-460.

Product Specifications

Product Name Alternative

Probable elastin-binding protein ebpS

UniProt

Q8CP59

Expression Region

1-460

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNNNFKDDFEKNRQSINPDEQQTELKEDDKTNENKKEADSQNSLSNNSNQQFPPRNAQR RKRRRETATNQSKQQDDKHQKNSDAKTTEGSLDDRYDEAQLQQQHDKSQQQNKTEKQSQD NRMKDGKDAAIVNGTSESPEHKSKSTQNRPGPKAQQQKRKSESTQSKPSTNKDKKAATGA GIAGAAGVAGAAETSKRHHNKKDKQDSKHSNHENDEKSVKNDDQKQSKKGKKAAVGAGAA AGVGAAGVAHHNNQNKHHNEEKNSNQNNQYNDQSEGKKKGGFMKILLPLIAAILILGAIA IFGGMALNNHNDSKSDDQKIANQSKKDSDKKDGAQSEDNKDKKSDSNKDKKSDSDKNADD DSDNSSSNPNATSTNNNDNVANNNSNYTNQNQQDNANQNSNNQQATQGQQSHTVYGQENL YRIAIQYYGEGTQANVDKIKRANGLSSNNIHNGQTLVIPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Activity Regulated Cytoskeleton Associated Protein (ARC), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031508 96 Tests

Multiplex Assay Kit for Activity Regulated Cytoskeleton Associated Protein (ARC), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
ZNF354C Rabbit Polyclonal Antibody (APC-Cy7)
orb2378545 100 µL

ZNF354C Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
PHD1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-4251R-BF647 100 µL

PHD1 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Monkey Purine Nucleoside Phosphorylase ELISA Kit
MBS747423-01 48 Well

Monkey Purine Nucleoside Phosphorylase ELISA Kit

Sign In for Pricing
View Details
Monkey Purine Nucleoside Phosphorylase ELISA Kit
MBS747423-02 96 Well

Monkey Purine Nucleoside Phosphorylase ELISA Kit

Sign In for Pricing
View Details
Monkey Purine Nucleoside Phosphorylase ELISA Kit
MBS747423-03 5x 96 Well

Monkey Purine Nucleoside Phosphorylase ELISA Kit

Sign In for Pricing
View Details