Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ESX-1 secretion system protein EccE1 (eccE1)

This Recombinant ESX-1 secretion system protein EccE1 (eccE1) spans the amino acid sequence from region 1-462.

Product Specifications

Product Name Alternative

ESX-1 secretion system protein EccE1, ESX conserved component E1, Type VII secretion system protein EccE1, T7SS protein EccE1

UniProt

O05462

Expression Region

1-462

Origin

Mycobacterium tuberculosis

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNPLGLRFSTGHALLASALAPPCIIAFLETRYWWAGIALASLGVIVATVTFYGRRITGW VAAVYAWLRRRRRPPDSSSEPVVGATVKPGDHVAVRWQGEFLVAVIELIPRPFTPTVIVD GQAHTDDMLDTGLVEELLSVHCPDLEADIVSAGYRVGNTAAPDVVSLYQQVIGTDPAPAN RRTWIVLRADPERTRKSAQRRDEGVAGLARYLVASATRIADRLASHGVDAVCGRSFDDYD HATDIGFVREKWSMIKGRDAYTAAYAAPGGPDVWWSARADHTITRVRVAPGMAPQSTVLL TTADKPKTPRGFARLFGGQRPALQGQHLVANRHCQLPIGSAGVLVGETVNRCPVYMPFDD VDIALNLGDAQTFTQFVVRAAAAGAMVTVGPQFEEFARLIGAHIGQEVKVAWPNATTYLG PHPGIDRVILRHNVIGTPRHRQLPIRRVSPPEESRYQMALPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAME (NM_001291717) Human Untagged Clone
SC336441 10 µg

PRAME (NM_001291717) Human Untagged Clone

Sign In for Pricing
View Details
Cystamine dihydrochloride
C09531-1g 1 g

Cystamine dihydrochloride

Sign In for Pricing
View Details
Human Serine/Threonine Kinase 39 (STK39) ELISA Kit
DLR-STK39-Hu-96T 96 Tests

Human Serine/Threonine Kinase 39 (STK39) ELISA Kit

Sign In for Pricing
View Details
Sheep Chromobox protein homolog 2 (CBX2) ELISA Kit
GTR10355181 96 Well

Sheep Chromobox protein homolog 2 (CBX2) ELISA Kit

Sign In for Pricing
View Details
CD180 Antigen (CD180) Antibody
abx139716 0.1 mg

CD180 Antigen (CD180) Antibody

Sign In for Pricing
View Details
CD207 antibody
MBS9406293-01 0.05 mL

CD207 antibody

Sign In for Pricing
View Details