Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ESX-1 secretion system protein EccE1 (eccE1)

This Recombinant ESX-1 secretion system protein EccE1 (eccE1) spans the amino acid sequence from region 1-462.

Product Specifications

Product Name Alternative

ESX-1 secretion system protein EccE1, ESX conserved component E1, Type VII secretion system protein EccE1, T7SS protein EccE1

UniProt

O05462

Expression Region

1-462

Origin

Mycobacterium tuberculosis

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNPLGLRFSTGHALLASALAPPCIIAFLETRYWWAGIALASLGVIVATVTFYGRRITGW VAAVYAWLRRRRRPPDSSSEPVVGATVKPGDHVAVRWQGEFLVAVIELIPRPFTPTVIVD GQAHTDDMLDTGLVEELLSVHCPDLEADIVSAGYRVGNTAAPDVVSLYQQVIGTDPAPAN RRTWIVLRADPERTRKSAQRRDEGVAGLARYLVASATRIADRLASHGVDAVCGRSFDDYD HATDIGFVREKWSMIKGRDAYTAAYAAPGGPDVWWSARADHTITRVRVAPGMAPQSTVLL TTADKPKTPRGFARLFGGQRPALQGQHLVANRHCQLPIGSAGVLVGETVNRCPVYMPFDD VDIALNLGDAQTFTQFVVRAAAAGAMVTVGPQFEEFARLIGAHIGQEVKVAWPNATTYLG PHPGIDRVILRHNVIGTPRHRQLPIRRVSPPEESRYQMALPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Human IgG Fc - Cy5
BS22128-01 100 µL

Mouse Anti-Human IgG Fc - Cy5

Sign In for Pricing
View Details
Mouse Anti-Human IgG Fc - Cy5
BS22128-02 500 µL

Mouse Anti-Human IgG Fc - Cy5

Sign In for Pricing
View Details
LC3B Recombinant Rabbit mAb, AP conjugated
orb3126263 100 µL

LC3B Recombinant Rabbit mAb, AP conjugated

Sign In for Pricing
View Details
GBF1 antibody
FNab03372 100 µg

GBF1 antibody

Sign In for Pricing
View Details
SKAR Polyclonal Antibody, RBITC Conjugated
bs-7922R-RBITC 100 µL

SKAR Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Human Cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1) ELISA Kit
orb1947764-01 48 Tests

Human Cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1) ELISA Kit

Sign In for Pricing
View Details