Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sleeping disease virus Structural polyprotein

This Recombinant Sleeping disease virus Structural polyprotein spans the amino acid sequence from region 861-1322.

Product Specifications

Product Name Alternative

Structural polyprotein, p130, Cleaved into the following 6 chains:, 1. Capsid protein, EC= 2. 3.4.21.-, Coat protein, C, p62, E3/E2

UniProt

Q8QL52

Expression Region

861-1322

Origin

Sleeping disease virus (SDV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEHTVVVPMDPRAPSYEAVINRNGYDPLKLTIAVNFTVISPTTALEYWTCAGVPVVEPPH VGCCTSVSCPSDLSTLHAFTGKAVSDVHCDVHTNVYPLLWGAAHCFCSTENTQVSAVAAT VSEFCAQDSERAEAFSVHSSSVTAEILVTLGEVVTAVHVYVDGVTSARGTDLKIVAGPIT TDYSPFDRKVVRIGEEVYNYDWPPYGAGRPGTFGDIQARSTNYVKPNDLYGDIGIEVLQP TNDHVHVAYTYTTSGLLRWLQDAPKPLSVTAPHGCKISANPLLALDCGVGAVPMSINIPD AKFTRKLKDPKPSALKCVVDSCEYGVDYGGAATITYEGHEAGKCGIHSLTPGVPLRTSVV EVVAGANTVKTTFSSPTPEVTLEVEICSAIVKCASECTPPKEHVVAARPRHGSDTGGYIS GPAMRWAGRIVGNPSGPVSSSLAVTYCVVKKCRSKRIRIVKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-4717-3p miRNA Inhibitor
MBS8294363-01 10 nmol

hsa-miR-4717-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-4717-3p miRNA Inhibitor
MBS8294363-02 20 nmol

hsa-miR-4717-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-4717-3p miRNA Inhibitor
MBS8294363-03 5x 20 nmol

hsa-miR-4717-3p miRNA Inhibitor

Sign In for Pricing
View Details
Collagen Type I (Biotin)
546071 200 µL

Collagen Type I (Biotin)

Sign In for Pricing
View Details
Daratumumab Biosimilar - Anti-CD38 mAb - Research Grade
PX-TA1213-1MG 1 mg

Daratumumab Biosimilar - Anti-CD38 mAb - Research Grade

Sign In for Pricing
View Details
RBM3 Polyclonal Conjugated Antibody
MBS9441855-01 0.1 mL (Biotin)

RBM3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details