Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sleeping disease virus Structural polyprotein

This Recombinant Sleeping disease virus Structural polyprotein spans the amino acid sequence from region 861-1322.

Product Specifications

Product Name Alternative

Structural polyprotein, p130, Cleaved into the following 6 chains:, 1. Capsid protein, EC= 2. 3.4.21.-, Coat protein, C, p62, E3/E2

UniProt

Q8QL52

Expression Region

861-1322

Origin

Sleeping disease virus (SDV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEHTVVVPMDPRAPSYEAVINRNGYDPLKLTIAVNFTVISPTTALEYWTCAGVPVVEPPH VGCCTSVSCPSDLSTLHAFTGKAVSDVHCDVHTNVYPLLWGAAHCFCSTENTQVSAVAAT VSEFCAQDSERAEAFSVHSSSVTAEILVTLGEVVTAVHVYVDGVTSARGTDLKIVAGPIT TDYSPFDRKVVRIGEEVYNYDWPPYGAGRPGTFGDIQARSTNYVKPNDLYGDIGIEVLQP TNDHVHVAYTYTTSGLLRWLQDAPKPLSVTAPHGCKISANPLLALDCGVGAVPMSINIPD AKFTRKLKDPKPSALKCVVDSCEYGVDYGGAATITYEGHEAGKCGIHSLTPGVPLRTSVV EVVAGANTVKTTFSSPTPEVTLEVEICSAIVKCASECTPPKEHVVAARPRHGSDTGGYIS GPAMRWAGRIVGNPSGPVSSSLAVTYCVVKKCRSKRIRIVKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PPP1R13B Knockout HEK293T cell line
GTR15416700 1 Vial

Human PPP1R13B Knockout HEK293T cell line

Sign In for Pricing
View Details
CLLD8 Rabbit Polyclonal Antibody (Cy5.5)
orb1085585 100 µL

CLLD8 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Mouse SCFR (Stem Cell Factor Receptor) ELISA Kit
MBS8801526-01 48 Well

Mouse SCFR (Stem Cell Factor Receptor) ELISA Kit

Sign In for Pricing
View Details
Mouse SCFR (Stem Cell Factor Receptor) ELISA Kit
MBS8801526-02 96 Well

Mouse SCFR (Stem Cell Factor Receptor) ELISA Kit

Sign In for Pricing
View Details
Mouse SCFR (Stem Cell Factor Receptor) ELISA Kit
MBS8801526-03 5x 96 Well

Mouse SCFR (Stem Cell Factor Receptor) ELISA Kit

Sign In for Pricing
View Details
Mouse SCFR (Stem Cell Factor Receptor) ELISA Kit
MBS8801526-04 10x 96 Well

Mouse SCFR (Stem Cell Factor Receptor) ELISA Kit

Sign In for Pricing
View Details