Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Northern cereal mosaic virus Glycoprotein G (G)

This Recombinant Northern cereal mosaic virus Glycoprotein G (G) spans the amino acid sequence from region 22-483.

Product Specifications

Product Name Alternative

Glycoprotein G

UniProt

Q9JGT4

Expression Region

22-483

Origin

Northern cereal mosaic virus (NCMV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LSILSCNKTDEVPTVTQCFKSCSDTILGEQVKVSILSQEDPTSIVVGRCIWRIMKQSFTE TWTFSRLISAKEITWEPATTQECNGAFHNLCKNKAGCVSEDLEIEPEFSWARTEIREVKH LSIETLTMSAYLHQGAGKVLIDGVAVPISKKTHNNGDFTYVWDDVPISEVCPWKHPISHL SCYKDKEDLDDIYCPSQGISLVNYTKVDTSCPEQIYTDVGGLVFKLGKVDFNDWYPYVIE SSDVAVKETISSINMALKMRESVHCHQDCLEIRRRVTYVDGFYYDPLPPAKCRLIGNCSV DSGSVTCNNGTLVWATCGGRRVWIDLKSGRDVKNAVCEKGGRSRISKNQFEGVLNEFHLN NSKFGNILRANEIHSVILKDNEVMDFARVVKSASERSGNFSEGTLINVRQLFRPMINFLR GIEHEIKVVAFSVLALIVGYIIIRIRTVTVAKAKSLESIAMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-100 1x 100 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-500 1x 500 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-100 1x 100 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF594 conjugate, 0.1mg/mL
BNC942085-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1492), CF405S conjugate, 0.1mg/mL
BNC041492-100 1x 100 µL

PAX8 (Renal Cell Marker) (PAX8/1492), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details