Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas phage Pf3 Attachment protein G3P (III)

This Recombinant Pseudomonas phage Pf3 Attachment protein G3P (III) spans the amino acid sequence from region 21-483.

Product Specifications

Product Name Alternative

Attachment protein G3P, Gene 3 protein, G3P, Minor coat protein

UniProt

P03624

Expression Region

21-483

Origin

Pseudomonas phage Pf3 (Bacteriophage Pf3)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGPVSTEVAAGTTTYRVTNTTVRTPPNVTLSPVRDITPYVEKIPNKGLAQAAQGRLIVAQ RAASVPVTGFFNVSGAVVKSGAKSFLRSAGRASGIGLGLAALLEAADWVFDEEGEIVKPL PGGGSPVLMPRPVILNEYTVTGSAGQWSISKEYEPDPRSVPGWYSYNGNPVWVSAVEDVG FTWRYWYFADVLMDGQGRPNYLVAYSDSGPNEYWQDVGGYSLDSLPTEPEFVPLTDAELE AGIDQYYEPDPDDWRNLFPYIEPDSFTIETPIPSLDLSPVVSSSTNNQTGKVTVTETTTS VDFEVSDNNSSQPSISVNETTTENVYVDGDLVSSETNTTVTNPPSSGTSTPPSSGSGSDF QLPSFCSWATAVCDWFDWTQEPIDEEPDLSGIISDIDDLERTKDISFGSKSCPAPIALDI EFLDMSVDLSFEWFCELAGIIYFMVMASAYVLAAYITLGVVRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TJP2 activation kit by CRISPRa
GA106284 1 Kit

Human TJP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human C6orf141 activation kit by CRISPRa
GA115250 1 Kit

Human C6orf141 activation kit by CRISPRa

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), CF568 conjugate, 0.1mg/mL
BNC682046-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WDR47 Antibody
KC-28449-01 50 μL

WDR47 Antibody

Sign In for Pricing
View Details
WDR47 Antibody
KC-28449-02 100 µL

WDR47 Antibody

Sign In for Pricing
View Details
WDR47 Antibody
KC-28449-03 1 mL

WDR47 Antibody

Sign In for Pricing
View Details