Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Coiled-coil domain-containing protein 47 (CCDC47)

This Recombinant Pongo abelii Coiled-coil domain-containing protein 47 (CCDC47) spans the amino acid sequence from region 21-483.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 47

UniProt

Q5RCI4

Expression Region

21-483

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVELEGQDENQEG DFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSKNKDPITIVDVPAHLQNSWESYYLEI LMVTGLLAYIMNYIIGKNKNSRLAQAWFNTHRELLESNFTLVGDDGTNKEATSTGKLNQE NEHIYNLWCSGRVCCEGMLIQLRFLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMETYV FAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHF LTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALL PLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAE KERIMNEEDPEKQRRLEEAALRRDQKKLEKKQMKMKQIKVKAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Block for one Deep Well Micro Plate
H5000-DWMP 1 Each

Block for one Deep Well Micro Plate

Sign In for Pricing
View Details
Human GAL1 (Galectin 1) ELISA Kit
E-EL-H1051-01 24 Tests

Human GAL1 (Galectin 1) ELISA Kit

Sign In for Pricing
View Details
Human GAL1 (Galectin 1) ELISA Kit
E-EL-H1051-02 48 Tests

Human GAL1 (Galectin 1) ELISA Kit

Sign In for Pricing
View Details
Human GAL1 (Galectin 1) ELISA Kit
E-EL-H1051-03 96 Tests

Human GAL1 (Galectin 1) ELISA Kit

Sign In for Pricing
View Details
Wasf1 Mouse Gene Knockout Kit (CRISPR)
KN519313 1 Kit

Wasf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EGR1 (N-term) Rabbit Polyclonal Antibody
AP17311PU-N 400 µL

EGR1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details