Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Coiled-coil domain-containing protein 47 (CCDC47)

This Recombinant Pongo abelii Coiled-coil domain-containing protein 47 (CCDC47) spans the amino acid sequence from region 21-483.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 47

UniProt

Q5RCI4

Expression Region

21-483

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVELEGQDENQEG DFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSKNKDPITIVDVPAHLQNSWESYYLEI LMVTGLLAYIMNYIIGKNKNSRLAQAWFNTHRELLESNFTLVGDDGTNKEATSTGKLNQE NEHIYNLWCSGRVCCEGMLIQLRFLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMETYV FAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHF LTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALL PLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAE KERIMNEEDPEKQRRLEEAALRRDQKKLEKKQMKMKQIKVKAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody [Clone ID: SPM334]
AM50105PU-T 20 µg

alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody [Clone ID: SPM334]

Sign In for Pricing
View Details
Mouse IL-12 (Interleukin 12) ELISA Kit
E-EL-M3062-01 24 Tests

Mouse IL-12 (Interleukin 12) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-12 (Interleukin 12) ELISA Kit
E-EL-M3062-02 48 Tests

Mouse IL-12 (Interleukin 12) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-12 (Interleukin 12) ELISA Kit
E-EL-M3062-03 96 Tests

Mouse IL-12 (Interleukin 12) ELISA Kit

Sign In for Pricing
View Details
MRPS27 (NM_015084) Human Over-expression Lysate
LY402416 100 µg

MRPS27 (NM_015084) Human Over-expression Lysate

Sign In for Pricing
View Details
Klrb1b Mouse Monoclonal Antibody [Clone ID: 28764]
TA363857 200 µg

Klrb1b Mouse Monoclonal Antibody [Clone ID: 28764]

Sign In for Pricing
View Details