Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPPB, Human (His, solution)

NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (His, solution) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NPPB Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nppb-protein-human-108a-a-his.html

Purity

98.0

Smiles

HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Molecular Formula

4879 (Gene_ID) P16860 (H27-H134) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Collagen I Coated Culture Ware - 96 wells  5plates/ pack
cAP-5002-w96 1 Pack

Human Collagen I Coated Culture Ware - 96 wells 5plates/ pack

Sign In for Pricing
View Details
Cnn3 (NM_028044) Mouse Tagged Lenti ORF Clone
MR204859L3 10 µg

Cnn3 (NM_028044) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
IRF3 sgRNA CRISPR Lentivector (Human) (Target 1)
K1098502 1.0 µg DNA

IRF3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Accn4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3599308 1.0 µg DNA

Accn4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
8-Aminoquinoline
RM7828-1G 1 unit

8-Aminoquinoline

Sign In for Pricing
View Details
NUDT15 Knockout A549 Polyclonal Cells
ARG10575 1 Million

NUDT15 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details