Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPPB, Human (His, solution)

NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (His, solution) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NPPB Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nppb-protein-human-108a-a-his.html

Purity

98.0

Smiles

HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Molecular Formula

4879 (Gene_ID) P16860 (H27-H134) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf52 siRNA Oligos set (Human)
13922171 3x 5 nmol

C16orf52 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Proflavine Hemisulfate
S4236-50mg 50 mg

Proflavine Hemisulfate

Sign In for Pricing
View Details
RAMP2 Protein Vector (Human) (pPM-C-HA)
PV114764 500 ng

RAMP2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Normal rat IgG1 Alexa Fluor® 405
sc-45073 200 µg/mL

Normal rat IgG1 Alexa Fluor® 405

Sign In for Pricing
View Details
IFI30 Recombinant Protein (Mouse)
RP142991 100 µg

IFI30 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Melatonin-Related Receptor (MTNRL, G-Protein-coupled Receptor 50, GPR50, H9, Mel1c, MGC125342) (MaxLight 650)
MBS6385288-01 0.1 mL

Melatonin-Related Receptor (MTNRL, G-Protein-coupled Receptor 50, GPR50, H9, Mel1c, MGC125342) (MaxLight 650)

Sign In for Pricing
View Details