Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPPB, Human (His, solution)

NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (His, solution) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NPPB Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nppb-protein-human-108a-a-his.html

Purity

98.0

Smiles

HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Molecular Formula

4879 (Gene_ID) P16860 (H27-H134) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPP1 Protein Vector (Human) (pPM-C-His)
PV039968 500 ng

SPP1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Biotin-PEG4-OH
MBS5768643 Inquire

Biotin-PEG4-OH

Sign In for Pricing
View Details
Toxoplasma P32
PT-A05615-01 100 µg

Toxoplasma P32

Sign In for Pricing
View Details
Toxoplasma P32
PT-A05615-02 500 µg

Toxoplasma P32

Sign In for Pricing
View Details
Toxoplasma P32
PT-A05615-03 1 mg

Toxoplasma P32

Sign In for Pricing
View Details
Human OR7A5 activation kit by CRISPRa
GA108922 1 Kit

Human OR7A5 activation kit by CRISPRa

Sign In for Pricing
View Details