Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPPB, Human (His, solution)

NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (His, solution) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

NPPB Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nppb-protein-human-108a-a-his.html

Purity

98.0

Smiles

HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH

Molecular Formula

4879 (Gene_ID) P16860 (H27-H134) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Solute Carrier Family 30, Member 5 (SLC30A5) ELISA Kit
MBS2706176-01 24 Strip Well

Mouse Solute Carrier Family 30, Member 5 (SLC30A5) ELISA Kit

Ask
View Details
Mouse Solute Carrier Family 30, Member 5 (SLC30A5) ELISA Kit
MBS2706176-02 48 Well

Mouse Solute Carrier Family 30, Member 5 (SLC30A5) ELISA Kit

Ask
View Details
Mouse Solute Carrier Family 30, Member 5 (SLC30A5) ELISA Kit
MBS2706176-03 96 Well

Mouse Solute Carrier Family 30, Member 5 (SLC30A5) ELISA Kit

Ask
View Details
Mouse Solute Carrier Family 30, Member 5 (SLC30A5) ELISA Kit
MBS2706176-04 5x 96 Well

Mouse Solute Carrier Family 30, Member 5 (SLC30A5) ELISA Kit

Ask
View Details
Mouse Solute Carrier Family 30, Member 5 (SLC30A5) ELISA Kit
MBS2706176-05 10x 96 Well

Mouse Solute Carrier Family 30, Member 5 (SLC30A5) ELISA Kit

Ask
View Details
NFH (NEFH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10A7]
TA801161AM 100 µL

NFH (NEFH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10A7]

Ask
View Details