Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Sterol regulatory element-binding protein 2 (srebf2)

This Recombinant Danio rerio Sterol regulatory element-binding protein 2 (srebf2) spans the amino acid sequence from region 1-464.

Product Specifications

Product Name Alternative

Sterol regulatory element-binding protein 2, SREBP-2, Sterol regulatory element-binding transcription factor 2, Cleaved into the following chain:, 1. Processed sterol regulatory element-bin

UniProt

A3KNA7

Expression Region

1-464

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDASEFMDTMDPSLSELGDEFTLGDIDEMLQFVSNQVDFPDIFEDQMGGGATARTLPQAV PSAILTPPHTPVQTSSQTHTQTLTQAHTQTHTQTHTQTRTPPVLQPRPQPITQVQTQTFP MQTLAVQTQAQPQTVMITPTATPSRFIQNQVICQQNNATSFQVLQPQMQSIMTSPQVQPM TIQHQRVLTPAGQTIQTLSTAPTTVHTMSQQVPVLVHQPQILKTDSLLLTTKPDGTQVLS TVQSPTGITTLTTPIQTTALQMPTLMSSNILTTVPVVMGGGDKLPIKQLSSGPAHNIGGA RVGVEQSPVVGPGGVVKEGERRTTHNIIEKRYRSSINDKILELRDLVLGNDAKMHKSGVL RKAIDYIKYLQQVNHKLRQENLTLKMANQKNKSACVSDVDLELKAEVSLISPPPSDSGSS SPAQLSPYCIDSEPGSPLLEHEQLKSEPDSPSCVGVMDRSRLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRFS1 siRNA (Human)
orb1863205-01 15 nmol

UQCRFS1 siRNA (Human)

Sign In for Pricing
View Details
UQCRFS1 siRNA (Human)
orb1863205-02 30 nmol

UQCRFS1 siRNA (Human)

Sign In for Pricing
View Details
Gga3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4545908 1.0 µg DNA

Gga3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
1-Cyclopropylpiperazine-2-carbonitrile dihydrochloride
JHD95006-01 50 mg

1-Cyclopropylpiperazine-2-carbonitrile dihydrochloride

Sign In for Pricing
View Details
1-Cyclopropylpiperazine-2-carbonitrile dihydrochloride
JHD95006-02 0.5 g

1-Cyclopropylpiperazine-2-carbonitrile dihydrochloride

Sign In for Pricing
View Details
T (T, Brachyury Homolog (mouse), MGC104817, TFT) (MaxLight 750)
MBS6451716-01 0.1 mL

T (T, Brachyury Homolog (mouse), MGC104817, TFT) (MaxLight 750)

Sign In for Pricing
View Details