Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Sterol regulatory element-binding protein 2 (srebf2)

This Recombinant Danio rerio Sterol regulatory element-binding protein 2 (srebf2) spans the amino acid sequence from region 1-464.

Product Specifications

Product Name Alternative

Sterol regulatory element-binding protein 2, SREBP-2, Sterol regulatory element-binding transcription factor 2, Cleaved into the following chain:, 1. Processed sterol regulatory element-bin

UniProt

A3KNA7

Expression Region

1-464

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDASEFMDTMDPSLSELGDEFTLGDIDEMLQFVSNQVDFPDIFEDQMGGGATARTLPQAV PSAILTPPHTPVQTSSQTHTQTLTQAHTQTHTQTHTQTRTPPVLQPRPQPITQVQTQTFP MQTLAVQTQAQPQTVMITPTATPSRFIQNQVICQQNNATSFQVLQPQMQSIMTSPQVQPM TIQHQRVLTPAGQTIQTLSTAPTTVHTMSQQVPVLVHQPQILKTDSLLLTTKPDGTQVLS TVQSPTGITTLTTPIQTTALQMPTLMSSNILTTVPVVMGGGDKLPIKQLSSGPAHNIGGA RVGVEQSPVVGPGGVVKEGERRTTHNIIEKRYRSSINDKILELRDLVLGNDAKMHKSGVL RKAIDYIKYLQQVNHKLRQENLTLKMANQKNKSACVSDVDLELKAEVSLISPPPSDSGSS SPAQLSPYCIDSEPGSPLLEHEQLKSEPDSPSCVGVMDRSRLLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Platelet Factor 4 (PF4) ELISA Kit
EKN47818 96 Tests

Rabbit Platelet Factor 4 (PF4) ELISA Kit

Sign In for Pricing
View Details
SIV p55, Recombinant (Simian Immunodeficiency Virus)
209205 2 µg

SIV p55, Recombinant (Simian Immunodeficiency Virus)

Sign In for Pricing
View Details
Human Semenogelin-2 (SEMG2) Elisa Kit
EK713642 96 Well

Human Semenogelin-2 (SEMG2) Elisa Kit

Sign In for Pricing
View Details
Ap3s1 (NM_009681) Mouse Tagged ORF Clone Lentiviral Particle
MR222053L3V 200 µL

Ap3s1 (NM_009681) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
VE Cadherin (CDH5) Human qPCR Primer Pair (NM_001795)
HP233196 200 Reactions

VE Cadherin (CDH5) Human qPCR Primer Pair (NM_001795)

Sign In for Pricing
View Details
MIR4536-2 ORF Vector (Human) (pORF)
ORF024453 1.0 µg DNA

MIR4536-2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details