Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Mitochondrial import inner membrane translocase subunit TIM50 (TIM50)

This Recombinant Ashbya gossypii Mitochondrial import inner membrane translocase subunit TIM50 (TIM50) spans the amino acid sequence from region 10-476.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM50

UniProt

Q75A73

Expression Region

10-476

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATSARQLPRVAGLLAGAAAVRSRTYIGTRILHEEQKPKKPEPPNSILTEDMLARAGVDAE RGPETEKAPAEDKAGESTETGSGAGKKKRARKTTTEIKRERYANLFYLFSLTGLAGGAVY MSRDWDADEPEEERKGIENGYTPGLMYRRFKARFDSLFTFFQEPPYPDLLPPPTSPSYQR PLTLVLPLEDFFVHFEWTQQYGWRTVIRPGADYLLGYLSDYYENVLFPSNYMVYSKKVVE KLDPIRAFITYNLFKDHCVYKDGIHIKDLSHLNRDLGKTLIIDTDPNSVKLQMENAILAE PWDGKADDALLRYIPFLEYLVTQPINDVRPILNSFKDRHHIPEEFAERVEKLRAKFNADQ KAKAGSGLSFLLNPGMASKPAKFPLDLIREEGEKNYVRFMKLIEEEKEKLKLQQEHMSAP TFTLKDMAEGNMPTPEEQMKMQLQKQKEFEELYEKEKQKMQQQTKGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tas2r110 Mouse shRNA Plasmid (Locus ID 387344)
TR508691 1 Kit

Tas2r110 Mouse shRNA Plasmid (Locus ID 387344)

Sign In for Pricing
View Details
WDR77 siRNA (Rat)
CRR5283-01 15 nmol

WDR77 siRNA (Rat)

Sign In for Pricing
View Details
WDR77 siRNA (Rat)
CRR5283-02 30 nmol

WDR77 siRNA (Rat)

Sign In for Pricing
View Details
Mouse Bruton'S Tyrosine Kinase (Btk) ELISA Kit
MBS2024814-01 24 Strip Well

Mouse Bruton'S Tyrosine Kinase (Btk) ELISA Kit

Sign In for Pricing
View Details
Mouse Bruton'S Tyrosine Kinase (Btk) ELISA Kit
MBS2024814-02 48 Strip Well

Mouse Bruton'S Tyrosine Kinase (Btk) ELISA Kit

Sign In for Pricing
View Details
Mouse Bruton'S Tyrosine Kinase (Btk) ELISA Kit
MBS2024814-03 96 Strip Well

Mouse Bruton'S Tyrosine Kinase (Btk) ELISA Kit

Sign In for Pricing
View Details