Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome c biogenesis protein CcsB (ccsB)

This Recombinant Synechococcus sp. Cytochrome c biogenesis protein CcsB (ccsB) spans the amino acid sequence from region 1-469.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsB

UniProt

Q2JNP5

Expression Region

1-469

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVIYSLPLARWVSSLRRYFRHELLPLLADLRLAIGLLLAIAVLSATGTVIEQEETAAFYQ AHYPEHPALFGFLTWRVILSLGLDHVYRTPWFLAILILFGSSLAACSLTRQWPMLKRARR WSYLTRPQSFQRLPFRTYLPQQSLQGLPQQLRRQGYLVFQEGHYLYARKGLIGRIGPILV HVSMLLILLGAIWGSISGFKAQELIPSGGVASIQHLTGAGDLARAHLPTWQIRANRFWID YAADGRVKQFYSDLSILDQGQEVKRQTISVNHPLSYRGVTLYQADWSIDSIRIRINNSPT FQIPVVPVRTEAGNKLWGAFVPTQPDMSQGLTLLLPDLQGTALLYDTEGQWMGSLRQGMS LALDEVAPQRFPNPLTLYLDEVIGATGLQIKSDPGIPAVYLGFGLLMVGVVMSYFSYSQI WALQTETGLYLGGKTNRALVTFEREFDRLVEQQKVAFSLSQIPVEAEIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-100 1x 100 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-100 1x 100 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-500 1x 500 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-500 1x 500 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details