Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ESX-4 secretion system protein eccB4 (eccB4)

This Recombinant ESX-4 secretion system protein eccB4 (eccB4) spans the amino acid sequence from region 1-470.

Product Specifications

Product Name Alternative

ESX-4 secretion system protein eccB4, ESX conserved component B4, Type VII secretion system protein eccB4, T7SS protein eccB4

UniProt

O06317

Expression Region

1-470

Origin

Mycobacterium tuberculosis

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSPATTWLHVSGYRFLLRRIECALLFGDVCAATGALRARTTSLALGCVLAIVAAMGCAF VALLRPQSALGQAPIVMGRESGALYVRVDDVWHPVLNLASARLIAATNANPQPVSESELG HTKRGPLLGIPGAPQLLDQPLAGAESAWAICDSDNGGSTTVVVGPAEDSSAQVLTAEQMI LVATESGSPTYLLYGGRRAVVDLADPAVVWALRLQGRVPHVVAQSLLNAVPEAPRITAPR IRGGGRASVGLPGFLVGGVVRITRASGDEYYVVLEDGVQRIGQVAADLLRFGDSQGSVNV PTVAPDVIRVAPIVNTLPVSAFPDRPPTPVDGSPGRAVTTLCVTWTPAQPGAARVAFLAG SGPPVPLGGVPVTLAQADGRGPALDAVYLPPGRSAYVAARSLSGGGTGTRYLVTDTGVRF AIHDDDVAHDLGLPTAAIPAPWPVLATLPSGPELSRANASVARDTVAPGP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SQSTM1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2283008 1.0 µg DNA

SQSTM1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
CD244 Antibody
A43927-50UL 50 μL

CD244 Antibody

Sign In for Pricing
View Details
Anti-cotton rat IFN-γ mAb (MT417), PF647P
3121-72-100T 100 Tests

Anti-cotton rat IFN-γ mAb (MT417), PF647P

Sign In for Pricing
View Details
Recombinant Mouse QSOX1 Protein, His Tag
32-17906-100 100 µg

Recombinant Mouse QSOX1 Protein, His Tag

Sign In for Pricing
View Details
XFD647 Anti-human CD99 Antibody *HIT4*
10991180-AAT 100 Tests

XFD647 Anti-human CD99 Antibody *HIT4*

Sign In for Pricing
View Details
3- (4-Bromophenyl) oxetan-3-ol
TTB87832-01 0.5 g

3- (4-Bromophenyl) oxetan-3-ol

Sign In for Pricing
View Details