Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Regulator of microtubule dynamics protein 3 (Fam82a2)

This Recombinant Mouse Regulator of microtubule dynamics protein 3 (Fam82a2) spans the amino acid sequence from region 1-470.

Product Specifications

Product Name Alternative

Regulator of microtubule dynamics protein 3, RMD-3, mRMD-3, Protein FAM82A2, Protein FAM82C

UniProt

Q3UJU9

Expression Region

1-470

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRLGALGGSRAGLGLLLGTAAGLGFLCVLYSQRWKRTQRHGRSHSLPNSLDYAQASERG RQVTQFRAIPGEAGDAAILPSLSQEGQEKVLDRLDFVLTSLMALRREVEELQRSLQGLAG EIVGEVRSHIEENQRVARRRRFPFARERSDSTGSSSVYFTASSGAALTDAESEGGYTTAN AESDYERDSDKESGDAEDEVSCETVRMGRKDSLDLDVEAASSPAAAALEEDDSSGREDVQ LVLLQADELHQGSKQDKREGFQLLLNNKLAYGSRQDFLWRLARAYSDMSDLTEEESGKKS YALNGKEEAEAALKKGDESAACHLWYAVLCGQLAEHEGISKRIQSGFSFKEHVDKAIELQ PEDPRGHFLLGRWCYQVSHLNWLEKKTATALFESPLSATVQDALQSFLKAEELQPGFSKA GRVYISKCYRELGKNSEARKWMKLAQELPDVTNEDSAFQKDLEELEVILG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-100 1x 100 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-500 1x 500 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL
BNC880978-500 1x 500 µL

CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-100 1x 100 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-100 1x 100 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details