Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative mycofactocin biosynthesis glycosyltransferase MftF (mftF)

This Recombinant Putative mycofactocin biosynthesis glycosyltransferase MftF (mftF) spans the amino acid sequence from region 1-470.

Product Specifications

Product Name Alternative

Putative mycofactocin biosynthesis glycosyltransferase MftF, EC= 2.-.-.-

UniProt

P95042

Expression Region

1-470

Origin

Mycobacterium tuberculosis

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATRLPDGFAVQVDRRVRVLGDGSALLGGSPTRLLRLAPAARGLLCDGRLKVRDEVSAE LARILLDATVAHPRPPSGPSHRDVTVVIPVRNNASGLRRLVTSLRGLRVIVVDDGSACPV ESDDFVGAHCDIEVLHHPHSKGPAAARNTGLAACTTDFVAFLDSDVTPRRGWLESLLGHF CDPTVALVAPRIVSLVEGENPVARYEALHSSLDLGQREAPVLPHSTVSYVPSAAIVCRSS AIRDVGGFDETMHSGEDVDLCWRLIEAGARLRYEPIALVAHDHRTQLRDWIARKAFYGGS AAPLAVRHPDKTAPLVISGGALMAWILMSIGTGLGRLASLVIAVLTGRRIARAMRCAETS FLDVLAVATRGLWAAALQLASAICRHYWPLALLAAILSRRCRRVVLIAAVVDGVVDWLRR REGADDDAEPIGPLTYLVLKRVDDLAYGAGLWYGVVRERNIGALKPQIRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-500 1x 500 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details