Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lithobates berlandieri Probable glutamate receptor

This Recombinant Lithobates berlandieri Probable glutamate receptor spans the amino acid sequence from region 18-487.

Product Specifications

Product Name Alternative

Probable glutamate receptor, Kainate-binding protein, KBP

UniProt

P20262

Expression Region

18-487

Origin

Lithobates berlandieri (Rio Grande leopard frog) (Rana berlandieri)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

HTDGKENAETLLKERTKRQIPKTLTVTTILEKPFAMKTESDALEGYAIDLLSELTQSLGF NYTLHIVKDGKYGSKDQEGNWSGMVGEIIRKEADLAIAPLTITSVRENAISFTKPFMQTG IGILLKKDTAAESSYMFGFLNPFSKELWIGIIISYVITSLCLFLVGRLSPCEWTEPASEQ NQFTLLNSLWYGVGALTLQGAEPQPKALSARIIAVIWWVFSITLLAAYIGSFASYINSNT NQTPNIQSVEDLLKQDKLDFGTLSNSSTLNFFKNSKNPTFQMIYEYMDKRKDRVLVKTFS EGVQRVRESNYAFLGESISQDFVVAKHCDLIRAPEMIGGRGYGIAAELDSPLIRPLTIAI LELFESGKLEYLRQKWWENTCSTQDQTGWVPVQPHTLGGIFLILGIGLALGLIVSFMELM CKSRSNAEQQKKSCCSAFSEEIAQRFGKTQNQEGLEKKSPTSNSCDEVKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-100 1x 100 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-100 1x 100 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3), CF405S conjugate, 0.1mg/mL
BNC040705-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF594 conjugate, 0.1mg/mL
BNC942221-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF568 conjugate, 0.1mg/mL
BNC681506-500 1x 500 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details