Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Mitochondrial import inner membrane translocase subunit TIM54 (TIM54)

This Recombinant Ashbya gossypii Mitochondrial import inner membrane translocase subunit TIM54 (TIM54) spans the amino acid sequence from region 1-472.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit TIM54

UniProt

Q758C9

Expression Region

1-472

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMGEFKHPPQEKQKMSSTKKAGYSNPAFAAMGIPALRLPGPKWCAFWLVVGAGIAGVVYD KREQRRICKHYSSLVKDQGAAHMDTWLKPRRLTVFVAPPPGDYLETSMKVWRRYVKQVLF EAGLDYEVFTEERQGVIRHEVAERVRQLRRDIAAAEAAEQRALDEKRWLNRMRSWWRREK LSEEELERIRAQKFRDEFTYKQLLGVFYKNAPLREQKVWDADALVEDPVLAGGVICIGRG AYKEYIAGIHEGTLGPLDPPTLTPEAPTELSVAAEDLTQAPEQSEPSAAVEALKQALEQA EHSPAEPDSAATDAPDEKSNNAHAPPPAPYVSPDEYSSLSLSQELVGDVHHPSSHIPALF HQPLLVIPVPNLSGFLQTPRKIYRFYTRRYYAEECCKAAAAMVLQTIRPFQPDDLNLGIS EEEDWPRRWVEQGRERKSEWVQDLKADPRVIAELHVVDPALMADLAATMNLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-500 1x 500 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-500 1x 500 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-500 1x 500 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF405S conjugate, 0.1mg/mL
BNC040176-100 1x 100 µL

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details