Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana NAC domain-containing protein 68 (NAC68)

This Recombinant Arabidopsis thaliana NAC domain-containing protein 68 (NAC68) spans the amino acid sequence from region 1-473.

Product Specifications

Product Name Alternative

NAC domain-containing protein 68, ANAC068, Protein NAC WITH TRANSMEMBRANE MOTIF 1

UniProt

A8MQY1

Expression Region

1-473

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMKGLIGYRFSPTGEEVINHYLKNKLLGKYWLVDEAISEINILSHKPSKDLPKLARIQSE DLEWYFFSPIEYTNPNKMKMKRTTGSGFWKPTGVDREIRDKRGNGVVIGIKKTLVYHEGK SPHGVRTPWVMHEYHITCLPHHKRKYVVCQVKYKGEAAEISYEPSPSLVSDSHTVIAITG EPEPELQVEQPGKENLLGMSVDDLIEPMNQQEEPQGPHLAPNDDEFIRGLRHVDRGTVEY LFANEENMDGLSMNDLRIPMIVQQEDLSEWEGFNADTFFSDNNNNYNLNVHHQLTPYGDG YLNAFSGYNEGNPPDHELVMQENRNDHMPRKPVTGTIDYSSDSGSDAGSISTTSYQGTSS PNISVGSSSRHLSSCSSTDSCKDLQTCTDPSIISREIRELTQEVKQEIPRAVDAPMNNES SLVKTEKKGLFIVEDAMERNRKKPRFIYLMKMIIGNIISVLLPVKRLIPVKKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lambda Light Chain (LcN-2 + ICO-106), CF405S conjugate, 0.1mg/mL
BNC040735-100 1x 100 µL

Human Lambda Light Chain (LcN-2 + ICO-106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-100 1x 100 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/1120), CF640R conjugate, 0.1mg/mL
BNC401120-100 1x 100 µL

Ep-CAM / CD326 (EGP40/1120), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF488A conjugate, 0.1mg/mL
BNC881577-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF647 conjugate, 0.1mg/mL
BNC472171-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF488A conjugate, 0.1mg/mL
BNC881798-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details